DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and kcnk5b

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:196 Identity:50/196 - (25%)
Similarity:86/196 - (43%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHE 141
            |.|..::|.|..:|..:|.:||.| :::.:....|::.:            |:|  :.:..|..|
Zfish     6 PILTSVIIFYLSIGAAIFQILEEP-NLNSAVDDYKNKTN------------NLL--KKYPCLSKE 55

  Fly   142 QLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITT 206
            .|    |.|:....:.:     |.|..:..|...:             :|::..|::::.|||||
Zfish    56 VL----GEIIEVVAEAT-----GQGVTVTKEAQFN-------------NWNWENAVIFAATVITT 98

  Fly   207 IGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGA------------LLADGLQCTYVRLCCQ 259
            ||:|::.|:|..|:|..|.|.|.|:||.|..:|.||.            ||..||....|:..|.
Zfish    99 IGYGNVAPKTTGGRLFCILYGLCGIPLCLTWISELGTFFGSRTKRLSQLLLHSGLNVRKVQFICT 163

  Fly   260 L 260
            :
Zfish   164 I 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 26/67 (39%)
Ion_trans_2 822..896 CDD:285168
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 24/68 (35%)
Ion_trans <142..234 CDD:278921 6/23 (26%)
Ion_trans_2 171..243 CDD:285168
C_Hendra 258..>323 CDD:293426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.