DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnf1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_963289.3 Gene:Kcnf1 / 382571 MGIID:2687399 Length:493 Species:Mus musculus


Alignment Length:170 Identity:37/170 - (21%)
Similarity:57/170 - (33%) Gaps:52/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ALGHFGYDA-GDSQSWSFSEALL--------YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
            |:|.|.:.| |.:...|..|.|.        :::..:||:|:|.:.|:|..|||......|.||.
Mouse   332 AVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVI 396

  Fly   233 LMLMCLSSLGALLADGLQCTYVRLC-------------CQLQRHQEHRRKSTPGTST-------- 276
            .:        ||....:...:||..             .:|........:..||.|.        
Mouse   397 AI--------ALPIHPIINNFVRYYNKQRVLETAAKHELELMELNSSSAEGKPGGSRSDLDTLPP 453

  Fly   277 -------PSASSAANSREKDT-------DKRSKRRMANCK 302
                   ||..|.......||       :|..:.|:.:||
Mouse   454 EPAAREGPSWGSRLKLSHSDTFIPLLTEEKHHRTRLQSCK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 22/78 (28%)
Ion_trans_2 822..896 CDD:462301
Kcnf1NP_963289.3 BTB_POZ_Kv5_KCNF1 23..138 CDD:349690
Ion_trans 181..417 CDD:459842 24/92 (26%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..468 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.