DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNS2

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_065748.1 Gene:KCNS2 / 3788 HGNCID:6301 Length:477 Species:Homo sapiens


Alignment Length:96 Identity:25/96 - (26%)
Similarity:46/96 - (47%) Gaps:31/96 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   817 ISLVLLILASYICVGTVIFAL-------WEN---------WSLVDGAYFCFVTLSTIGYGDFVPA 865
            :.|:||    |:.||..||::       .||         |      ::..|:::|:||||.||.
Human   329 VGLLLL----YLSVGISIFSVVAYTIEKEENEGLATIPACW------WWATVSMTTVGYGDVVPG 383

  Fly   866 RSFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
            .:  ..:|...||   :|.|:::|.:..:::
Human   384 TT--AGKLTASAC---ILAGILVVVLPITLI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 23/89 (26%)
KCNS2NP_065748.1 BTB_POZ_KCNS2 18..124 CDD:349734
Ion_trans 186..421 CDD:459842 25/96 (26%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.