DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK2

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001017425.2 Gene:KCNK2 / 3776 HGNCID:6277 Length:426 Species:Homo sapiens


Alignment Length:242 Identity:59/242 - (24%)
Similarity:95/242 - (39%) Gaps:91/242 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TASLTAKPRSSLRRCCGHLLKLLFSTPGLV-----------------------LLVIGYSVLGGL 92
            :|:..:|||            |.|||...|                       |:|:.|.::|..
Human    26 SAAQNSKPR------------LSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGAT 78

  Fly    93 LFPLLEAPQDISKSAAIA------KSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIV 151
            :|..||.|.:||:...|.      .|:..|:.     :.:|:.|.::                ||
Human    79 VFKALEQPHEISQRTTIVIQKQTFISQHSCVN-----STELDELIQQ----------------IV 122

  Fly   152 AATRQGSAGSSGGGGAGLFHEGSAS-ALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPR 215
            ||.           .||:...|:.| .:.|          |....:..::.|||||||.|:::||
Human   123 AAI-----------NAGIIPLGNTSNQISH----------WDLGSSFFFAGTVITTIGFGNISPR 166

  Fly   216 TAAGKLATIFYALVGVPLMLMCLS----SLGALLADGL---QCTYVR 255
            |..||:..|.|||:|:||....|:    .||.:...|:   :.|:::
Human   167 TEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/59 (41%)
Ion_trans_2 822..896 CDD:285168
KCNK2NP_001017425.2 Ion_trans_2 <142..196 CDD:400301 22/53 (42%)
Ion_trans_2 234..312 CDD:400301
Required for basal channel activity. /evidence=ECO:0000250 354..426
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9913
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.