DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNC3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_004968.2 Gene:KCNC3 / 3748 HGNCID:6235 Length:757 Species:Homo sapiens


Alignment Length:95 Identity:25/95 - (26%)
Similarity:48/95 - (50%) Gaps:25/95 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 LILASYICVGTVIFA----------------LWENW----SLVDGAYFCFVTLSTIGYGDFVPAR 866
            |:|..::.:|.:|||                |..|.    ::..|.::..||::|:||||..| :
Human   449 LLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYP-K 512

  Fly   867 SFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
            :::|  :.:.|.||  |.|::.:||...::
Human   513 TWSG--MLVGALCA--LAGVLTIAMPVPVI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 25/93 (27%)
KCNC3NP_004968.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
Important for normal N-type inactivation. /evidence=ECO:0000269|PubMed:26997484 1..78
Potassium_chann 1..>18 CDD:431870
BTB_KCNC1_3 89..202 CDD:349721
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..232
Ion_trans 289..550 CDD:459842 25/95 (26%)
Selectivity filter. /evidence=ECO:0000250 503..508 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..613
PHA03247 <637..752 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..746
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.