DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNC2

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_631875.1 Gene:KCNC2 / 3747 HGNCID:6234 Length:638 Species:Homo sapiens


Alignment Length:171 Identity:41/171 - (23%)
Similarity:63/171 - (36%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLM----CLSSLGALLADGLQCTYVRLCCQ 259
            ::|..:||:|:|.:.|:|.:|.|.....||.||..:.|    .:::.|         .|..|...
Human   430 WAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFG---------MYYSLAMA 485

  Fly   260 LQRHQEHRRKSTPGTSTPSASS----------AANSREKDTDKRSKRRMANCKGCQY---DAANS 311
            .|:....|:|..|  ..|.|||          |.||.:.||......|:........   |:..|
Human   486 KQKLPRKRKKHIP--PAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGS 548

  Fly   312 ETSLNDCLEYGQKGKLPPDK------------KEGDACQLL 340
            |..|:           ||::            :.|:.|.||
Human   549 EPPLS-----------PPERLPIRRSSTRDKNRRGETCFLL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 15/51 (29%)
Ion_trans_2 822..896 CDD:462301
KCNC2NP_631875.1 BTB_KCNC2_4 7..166 CDD:349722
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..93
Ion_trans 228..484 CDD:459842 17/62 (27%)
Selectivity filter. /evidence=ECO:0000250 437..442 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..572 6/44 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.