DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNA7

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_114092.2 Gene:KCNA7 / 3743 HGNCID:6226 Length:456 Species:Homo sapiens


Alignment Length:66 Identity:22/66 - (33%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVG 230
            |..||    :||:.....|..||...|..|:..::|..:||:|:|.:.|.|..||:.....|:.|
Human   322 GVVLF----SSAVYFAEVDRVDSHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAG 382

  Fly   231 V 231
            |
Human   383 V 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 18/55 (33%)
Ion_trans_2 822..896 CDD:462301
KCNA7NP_114092.2 BTB_POZ_KCNA7 8..122 CDD:349715
Ion_trans 199..404 CDD:459842 22/66 (33%)
Selectivity filter. /evidence=ECO:0000250 358..363 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.