DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNA6

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_002226.1 Gene:KCNA6 / 3742 HGNCID:6225 Length:529 Species:Homo sapiens


Alignment Length:66 Identity:22/66 - (33%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVG 230
            |..||    :||:.....|..||...|..:|..::|..:||:|:|.:.|.|..||:.....|:.|
Human   386 GVILF----SSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAG 446

  Fly   231 V 231
            |
Human   447 V 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 18/55 (33%)
Ion_trans_2 822..896 CDD:462301
KCNA6NP_002226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..233
Ion_trans 259..468 CDD:459842 22/66 (33%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 360..373
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 422..427 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513
PDZ-binding. /evidence=ECO:0000255 527..529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.