DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and sand

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster


Alignment Length:297 Identity:88/297 - (29%)
Similarity:138/297 - (46%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RSSLRR-----------CCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEA-PQDISKSAA--- 108
            |||.||           .|.|....:||..|::|||..|.:.|..:|..:|. ..:..||..   
  Fly     5 RSSFRRREKPAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHR 69

  Fly   109 -IAKS-REDCLRELWIIT-EKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLF 170
             ||:: ..:||..:|.:| |.::......:...|::.|..::.:||....:|.            
  Fly    70 FIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGP------------ 122

  Fly   171 HEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLML 235
                            |.:.||||.|.|||:|||||||:|::||.:..|||.||.||::|:||.|
  Fly   123 ----------------DVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFL 171

  Fly   236 MCLSSLGALLADGLQCTYVRLC-CQ-----------------------LQRH-QEHRRKSTPGTS 275
            :.||::|.:||...:..|.::| |:                       ||.| .|:.|.|:..||
  Fly   172 LYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTS 236

  Fly   276 TPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSE 312
            |.|.:|:.:|..:.|  ||.|:.::....||..::|:
  Fly   237 TSSTTSSNSSSSEYT--RSSRQSSSLVDIQYTESDSD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 33/55 (60%)
Ion_trans_2 822..896 CDD:285168
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 34/59 (58%)
Ion_trans_2 292..377 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461324
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm41373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.