DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and KCNK18

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_862823.1 Gene:KCNK18 / 338567 HGNCID:19439 Length:384 Species:Homo sapiens


Alignment Length:195 Identity:56/195 - (28%)
Similarity:85/195 - (43%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RRCCGHLLKLLFSTPGLVLL--VIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITE 125
            ||||...|..||  |||..|  ::.|:::|.::|..:|..|.:  .||.....|..|.||..|  
Human    10 RRCCPEALGKLF--PGLCFLCFLVTYALVGAVVFSAIEDGQVL--VAADDGEFEKFLEELCRI-- 68

  Fly   126 KLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQS 190
             ||..     ..:|.::.:..:|.:.....|            .|:.               :..
Human    69 -LNCS-----ETVVEDRKQDLQGHLQKVKPQ------------WFNR---------------TTH 100

  Fly   191 WSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVR 255
            |||..:|.:..||.:|:|:|.:.|.|..||...:.|||.|:|||.:.|:..|.:||..|..:|.|
Human   101 WSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNR 165

  Fly   256  255
            Human   166  165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 23/69 (33%)
Ion_trans_2 822..896 CDD:462301
KCNK18NP_862823.1 Ion_trans_2 94..155 CDD:462301 23/75 (31%)
Selectivity filter 1. /evidence=ECO:0000305|PubMed:36426390 116..121 2/4 (50%)
Interaction with calcineurin. /evidence=ECO:0000250|UniProtKB:Q6VV64 200..205
Interaction with YWHAH. /evidence=ECO:0000250|UniProtKB:Q6VV64 249..254
Ion_trans_2 285..364 CDD:462301
Selectivity filter 2. /evidence=ECO:0000305|PubMed:36426390 323..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.