DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Shaw

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster


Alignment Length:237 Identity:56/237 - (23%)
Similarity:77/237 - (32%) Gaps:85/237 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 TAVNLVTASEASTSTLEAITLPPPPAYQTASV---HAVRRAKF---------VAKP----LPQEI 554
            |.:.:...:..:.:.:..|.||.|......::   |...|||.         |.:|    ||...
  Fly   402 TYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAP 466

  Fly   555 NALMDCGTGSPDLSGRHDLLPPPHSGSPAT-GTAASPLLTYTAAATSP----QLSAGIKGGS--- 611
            ..:..|||..   ||       ||||...: ||....:...|....||    ||.||..|.|   
  Fly   467 GGVSGCGTPG---SG-------PHSGPMGSGGTGPRRMNNKTKDLVSPKSVAQLFAGPLGASIVA 521

  Fly   612 ---------GPAPTAGAPML---------------VSGAGRGAAALTDNGFMAAGV---CGMGAA 649
                     .||...|.|..               ||.||         |..|:|:   ...||.
  Fly   522 MSPRTMLDLNPALAMGKPTFQPRIPTPLAATPPPPVSSAG---------GMTASGIGTTSATGAT 577

  Fly   650 AAPLPVT---------------SMGAATTTASSAASTLSALL 676
            :||.|.|               .:|.:|||.::..::..|.|
  Fly   578 SAPQPATPLPSIAVSTTASVGKDLGISTTTTTAQETSKKAFL 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301
ShawNP_001137782.1 BTB_Shaw-like 24..135 CDD:349723
Ion_trans 188..439 CDD:459842 6/36 (17%)
PRK14959 <418..>585 CDD:184923 48/185 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.