DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk18

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_997144.1 Gene:Kcnk18 / 332396 MGIID:2685627 Length:394 Species:Mus musculus


Alignment Length:360 Identity:82/360 - (22%)
Similarity:126/360 - (35%) Gaps:114/360 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LTAKPRSSLRRCCGHLL------------KLLFSTPGLVLL--VIGYSVLGGLLFPLLEAPQD-- 102
            :.|:.....||||...|            |||   |||..|  ::.|:::|..||..:|...|  
Mouse     1 MEAEEPPEARRCCPEALGKARGCCPEALGKLL---PGLCFLCCLVTYALVGAALFSAVEGRPDPE 62

  Fly   103 ISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGA 167
            ..::..:.|..:|....|     |.|:.........:.|.|:..:...:.|              
Mouse    63 AEENPELKKFLDDLCNIL-----KCNLTVVEGSRKNLCEHLQHLKPQWLKA-------------- 108

  Fly   168 GLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
                                .|.|||..||.:..||.:|:|:|.:.|.|..||...:.|||.|:|
Mouse   109 --------------------PQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIP 153

  Fly   233 LMLMCLSSLGALLADGLQCTYVR----LC-------------CQLQRHQEHRRKS---------- 270
            ||.:.|:.:|.:||..|...|.|    ||             |:.|...:...::          
Mouse   154 LMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGV 218

  Fly   271 ------TPGTSTPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSETSLNDCLEYGQKGKLPP 329
                  .|....||.|......|:...:..|.::      |......|.| |.|.|. ..|:|  
Mouse   219 DELLNPQPSKDPPSPSCNVELFERLVAREKKNKL------QPPTRPVERS-NSCPEL-VLGRL-- 273

  Fly   330 DKKEGDACQLLRNLNPQQHFYQQQQQQPQQPDVML 364
                  :|.:|.||:       :..||.::.|:.|
Mouse   274 ------SCSILSNLD-------EVGQQVERLDIPL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
Kcnk18NP_997144.1 Ion_trans_2 <111..166 CDD:285168 23/54 (43%)
Interaction with calcineurin 210..215 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000269|PubMed:18397886 261..266 2/5 (40%)
Ion_trans_2 300..376 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.