DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and CG43155

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:106/237 - (44%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IDDETDATEFGGLGGVGGAGCGSEMGAKTTAS-LTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIG 85
            :|...||.|.||| ..|.||     |.::||. .:.|.:|:|    .|:        ||::.:..
  Fly    28 LDRRVDAAEGGGL-AKGTAG-----GRRSTACWQSMKWKSAL----NHI--------GLLVSLSI 74

  Fly    86 YSVLGGLLFPLLEAPQDISKSA----AIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRF 146
            |..:|||:|..||.|.::.:.:    .:...||..|..:      ||.....|...|:..:|.::
  Fly    75 YCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTI------LNNTEVHNLDELLSFELAKY 133

  Fly   147 EGSIVAATRQGSAGSSGGGGAGL-------FHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVI 204
            |    ||.:|.:.|       ||       |.|              ..:.||..:|:.:|.||:
  Fly   134 E----AAVQQAAEG-------GLLIVADKDFPE--------------PYERWSILQAVFFSSTVL 173

  Fly   205 TTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLA 246
            ||||:|::.|.|..|::..|.:||:|:|..|..::..|.|.|
  Fly   174 TTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/56 (41%)
Ion_trans_2 822..896 CDD:285168
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/56 (38%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461291
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
87.850

Return to query results.
Submit another query.