DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnf1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001162575.1 Gene:Kcnf1 / 298908 RGDID:631414 Length:505 Species:Rattus norvegicus


Alignment Length:170 Identity:38/170 - (22%)
Similarity:58/170 - (34%) Gaps:52/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ALGHFGYDA-GDSQSWSFSEALL--------YSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
            |:|.|.:.| |.:...|..|.|.        :::..:||:|:|.:.|:|..|||......|.||.
  Rat   344 AVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVI 408

  Fly   233 LMLMCLSSLGALLADGLQCTYVRLC-------------CQLQRHQEHRRKSTPGTST-------- 276
            .:        ||....:...:||..             .:|........:|.||.|.        
  Rat   409 AI--------ALPIHPIINNFVRYYNKQRVLETAAKHELELMELNSSSAESKPGGSRSDLDTLPP 465

  Fly   277 -------PSASSAANSREKDT-------DKRSKRRMANCK 302
                   ||..|.......||       :|..:.|:.:||
  Rat   466 EPAAREGPSWGSRLKLSHSDTFIPLLTEEKHHRTRLQSCK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 22/78 (28%)
Ion_trans_2 822..896 CDD:462301
Kcnf1NP_001162575.1 BTB_POZ_Kv5_KCNF1 35..150 CDD:349690
Ion_trans 193..429 CDD:459842 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.