DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_203694.1 Gene:Kcnk3 / 29553 RGDID:61997 Length:411 Species:Rattus norvegicus


Alignment Length:207 Identity:56/207 - (27%)
Similarity:85/207 - (41%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|::....|.::|..:|..||     |:...|.:.|.: ||:|     :|...|  |.:...:
  Rat     8 TLALIVCTFTYLLVGAAVFDALE-----SEPEMIERQRLE-LRQL-----ELRARY--NLSEGGY 59

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
            |:|.|    :|...:...||                            ..|.|:.:..:::||||
  Rat    60 EELER----VVLRLKPHKAG----------------------------VQWRFAGSFYFAITVIT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKS 270
            |||:|...|.|..||:..:||||:|:||.|:...|||..:.     |:|       |:..||.|.
  Rat    93 TIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERIN-----TFV-------RYLLHRAKR 145

  Fly   271 TPGTSTPSASSA 282
            ..|......|.|
  Rat   146 GLGMRHAEVSMA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 25/69 (36%)
Ion_trans_2 822..896 CDD:462301
Kcnk3NP_203694.1 Ion_trans_2 <73..132 CDD:462301 27/86 (31%)
Ion_trans_2 167..243 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.