DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk12

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_954859.1 Gene:Kcnk12 / 210741 MGIID:2684043 Length:430 Species:Mus musculus


Alignment Length:182 Identity:45/182 - (24%)
Similarity:70/182 - (38%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 GSEQFVLKKLRYHCDG--------------------KDCREAE--------------DSEEEDEK 809
            |.:.|::....:.|.|                    :.|||.:              .:..|.:.
Mouse   141 GGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADS 205

  Fly   810 ADGRQVPISLVLLILASY----ICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPA----- 865
            ..|.:..:..|||||..:    .|..:.::...|.|..||..||||||.||||:||.|.:     
Mouse   206 LAGWKPSVYHVLLILGLFAVLLACCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAY 270

  Fly   866 ------RSFNGPELQLYACCAYLLLGLVLVAMSFSILETQLM-WKCKRIAVR 910
                  |..|...:.|..||.|.|..::      |||..|:: |..::::.|
Mouse   271 RNQGLYRLGNFLFILLGVCCIYSLFNVI------SILIKQVLNWMLRKLSCR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 29/88 (33%)
Kcnk12NP_954859.1 Ion_trans_2 100..169 CDD:462301 4/27 (15%)
Ion_trans_2 222..304 CDD:462301 28/87 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.