DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-4

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001343566.1 Gene:twk-4 / 192079 WormBaseID:WBGene00006659 Length:418 Species:Caenorhabditis elegans


Alignment Length:200 Identity:44/200 - (22%)
Similarity:82/200 - (41%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIIT 124
            ::||....||: |:|:|       :.|.:.|..||..:|...::.:    .:|.....|..    
 Worm    83 ANLRLALFHLV-LIFAT-------VAYIIAGAYLFTKIEHQAELDR----YQSYHTIYRNF---- 131

  Fly   125 EKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAG--- 186
              :|.||:.:     :..:...|..|...|                      ::....:..|   
 Worm   132 --INNLYQSS-----NRSVADVENLIDTFT----------------------SINFRAFKEGLKP 167

  Fly   187 -------DSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGAL 244
                   ::..||...|:.::.||:|:||:|:|.|.:..||:..:.||:.|:||.|:.::.|...
 Worm   168 TDFLVPQETSRWSMISAIFFTTTVLTSIGYGNLIPISTGGKIFCVGYAIFGIPLTLVTIADLAKF 232

  Fly   245 LADGL 249
            :||.|
 Worm   233 VADML 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 20/55 (36%)
Ion_trans_2 822..896 CDD:285168
twk-4NP_001343566.1 Ion_trans_2 <178..235 CDD:311712 20/56 (36%)
Ion_trans_2 255..329 CDD:311712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7175
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.