DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-4

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001343566.1 Gene:twk-4 / 192079 WormBaseID:WBGene00006659 Length:418 Species:Caenorhabditis elegans


Alignment Length:200 Identity:44/200 - (22%)
Similarity:82/200 - (41%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIIT 124
            ::||....||: |:|:|       :.|.:.|..||..:|...::.:    .:|.....|..    
 Worm    83 ANLRLALFHLV-LIFAT-------VAYIIAGAYLFTKIEHQAELDR----YQSYHTIYRNF---- 131

  Fly   125 EKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAG--- 186
              :|.||:.:     :..:...|..|...|                      ::....:..|   
 Worm   132 --INNLYQSS-----NRSVADVENLIDTFT----------------------SINFRAFKEGLKP 167

  Fly   187 -------DSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGAL 244
                   ::..||...|:.::.||:|:||:|:|.|.:..||:..:.||:.|:||.|:.::.|...
 Worm   168 TDFLVPQETSRWSMISAIFFTTTVLTSIGYGNLIPISTGGKIFCVGYAIFGIPLTLVTIADLAKF 232

  Fly   245 LADGL 249
            :||.|
 Worm   233 VADML 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 21/79 (27%)
Ion_trans_2 822..896 CDD:462301
twk-4NP_001343566.1 Ion_trans_2 <174..235 CDD:462301 20/60 (33%)
Ion_trans_2 255..329 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.