DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-25

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_502170.4 Gene:twk-25 / 192076 WormBaseID:WBGene00006678 Length:683 Species:Caenorhabditis elegans


Alignment Length:243 Identity:61/243 - (25%)
Similarity:96/243 - (39%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TEFGGLGGVGGAGCGSE---------MGAKTTASLTAKPRS------------SLRRCCGHLLKL 72
            |.|....|.||.....:         ..:|.|.|:....||            |......:..|:
 Worm   221 TNFPRYAGYGGDNDDDDEAVRRNYNTTNSKKTMSMAQSTRSVPIVPVNNRFHKSFYWFAHNHKKI 285

  Fly    73 LFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWII--TEKLNVLYERNW 135
            .|....::|||:.|::||..||..:|:..: .::....|.:.|  |.::.|  |.:|.||.....
 Worm   286 GFRHVCMLLLVLLYTLLGAALFFSIESRHE-HETMHFHKRKLD--RIIYEIAQTLELEVLDPMKL 347

  Fly   136 TMLVHEQLRRFEGSIVAA-TRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLY 199
            |     .:.:.|..|..| .:..:|.....|.....||...:.            .|::..|..:
 Worm   348 T-----NITQMEYFITRAYVKLLNAEDLYSGSTFYKHEDPKNL------------KWTYGSAFFF 395

  Fly   200 SVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG--ALL 245
            |:.|.||.|:||:.|.::.||...|.|.|:.|||..:.:..||  |||
 Worm   396 SMNVYTTTGYGSIAPSSSLGKALVIVYGLIFVPLTAVVIRDLGQWALL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/57 (40%)
Ion_trans_2 822..896 CDD:285168
twk-25NP_502170.4 Ion_trans_2 370..440 CDD:285168 23/81 (28%)
Ion_trans <482..555 CDD:278921
Ion_trans_2 482..551 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.