Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506416.2 | Gene: | twk-32 / 192075 | WormBaseID: | WBGene00006684 | Length: | 614 | Species: | Caenorhabditis elegans |
Alignment Length: | 149 | Identity: | 44/149 - (29%) |
---|---|---|---|
Similarity: | 65/149 - (43%) | Gaps: | 28/149 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 749 RRCHRHASGTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCDGKDCREAEDSEEEDEKADGR 813
Fly 814 QVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARS-FNGPELQLYA 877
Fly 878 CCAYLLLGLVLVAMSFSIL 896 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | |
Ion_trans_2 | 822..896 | CDD:285168 | 27/74 (36%) | ||
twk-32 | NP_506416.2 | Ion_trans_2 | <125..180 | CDD:285168 | |
Ion_trans_2 | 251..325 | CDD:285168 | 27/75 (36%) | ||
FN3 | 392..485 | CDD:238020 | |||
FN3 | 491..580 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |