DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-32

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_506416.2 Gene:twk-32 / 192075 WormBaseID:WBGene00006684 Length:614 Species:Caenorhabditis elegans


Alignment Length:149 Identity:44/149 - (29%)
Similarity:65/149 - (43%) Gaps:28/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 RRCHRHASGTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCDGKDCREAEDSEEEDEKADGR 813
            ||..|..||.:      ..|:....:.:..|.|..|.:.|..|.               |.|...
 Worm   198 RRYKRWKSGRI------RRESMKVGQVIIAGGEDEVAEFLWTHL---------------EHAQFV 241

  Fly   814 QVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARS-FNGPELQLYA 877
            :||..||:.||..||.:.:.|.:..|||:::||.||..:::.|||:||.||... |..|.|.:  
 Worm   242 EVPFLLVIGILLLYIGLSSWIISWVENWNMMDGFYFVMMSVLTIGFGDLVPRNEIFAVPILFI-- 304

  Fly   878 CCAYLLLGLVLVAMSFSIL 896
                :|.||||......::
 Worm   305 ----ILAGLVLTTTCIDVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 27/74 (36%)
twk-32NP_506416.2 Ion_trans_2 <125..180 CDD:285168
Ion_trans_2 251..325 CDD:285168 27/75 (36%)
FN3 392..485 CDD:238020
FN3 491..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.