DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001293466.1 Gene:twk-1 / 192072 WormBaseID:WBGene00006656 Length:451 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:48/84 - (57%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 LILASYICVGTVIFALW-ENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPE--LQLYACCAYLL 883
            ::||::..:|.:||:|| :....:|..||.|::::||||||:.|.     ||  .|......||.
 Worm   182 ILLAAHCFIGALIFSLWIDQLDFLDAFYFSFISITTIGYGDYSPT-----PEGLFQYIIVTVYLC 241

  Fly   884 LGLVLVAMSFSILETQLMW 902
            .|:..:.:.|:.|:..:||
 Worm   242 TGVATMLLFFASLQKGIMW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 25/76 (33%)
twk-1NP_001293466.1 Ion_trans_2 76..149 CDD:462301
Ion_trans_2 182..256 CDD:462301 26/78 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.