DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-1

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001293466.1 Gene:twk-1 / 192072 WormBaseID:WBGene00006656 Length:451 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:48/84 - (57%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 LILASYICVGTVIFALW-ENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPE--LQLYACCAYLL 883
            ::||::..:|.:||:|| :....:|..||.|::::||||||:.|.     ||  .|......||.
 Worm   182 ILLAAHCFIGALIFSLWIDQLDFLDAFYFSFISITTIGYGDYSPT-----PEGLFQYIIVTVYLC 241

  Fly   884 LGLVLVAMSFSILETQLMW 902
            .|:..:.:.|:.|:..:||
 Worm   242 TGVATMLLFFASLQKGIMW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168
Ion_trans_2 822..896 CDD:285168 25/76 (33%)
twk-1NP_001293466.1 Ion_trans_2 76..156 CDD:285168
Ion_trans_2 182..260 CDD:285168 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.