DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-6

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_497973.1 Gene:twk-6 / 192070 WormBaseID:WBGene00006661 Length:347 Species:Caenorhabditis elegans


Alignment Length:267 Identity:54/267 - (20%)
Similarity:103/267 - (38%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TDATEFGGLGGVGGAGCGSEMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLG 90
            ||..|:.|         .::.|..|...::...|.:.|:....::.|   :..:.|||  ::::|
 Worm     3 TDEGEYSG---------DTDHGGSTMQKMSPNTRQNFRQNVNVVVCL---SAAITLLV--FNLIG 53

  Fly    91 GLLFPLLE---APQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVA 152
            ..:|.|.|   :.:.:::::.::|    ||..|.|                         |..:.
 Worm    54 AGIFYLAETQNSSESLNENSEVSK----CLHNLPI-------------------------GGKIT 89

  Fly   153 ATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTA 217
            |..:...|..         ...:|.:..||            :|:.:|.|:.:|:|:|||.|.:.
 Worm    90 AEMKSKLGKC---------LTKSSRIDGFG------------KAIFFSWTLYSTVGYGSLYPHST 133

  Fly   218 AGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKSTPGTSTPSASSA 282
            .|:..||||:|:.:|:.:......|..||..|.....|....:::......::.....|||    
 Worm   134 LGRYLTIFYSLLMIPVFIAFKFEFGTFLAHFLVVVSNRTRLAVKKAYYKLSQNPENAETPS---- 194

  Fly   283 ANSREKD 289
             ||.:.|
 Worm   195 -NSLQHD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 18/55 (33%)
Ion_trans_2 822..896 CDD:285168
twk-6NP_497973.1 Ion_trans_2 <109..163 CDD:285168 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.