DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and shw-3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001355445.1 Gene:shw-3 / 191761 WormBaseID:WBGene00004793 Length:500 Species:Caenorhabditis elegans


Alignment Length:108 Identity:25/108 - (23%)
Similarity:50/108 - (46%) Gaps:18/108 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 LLILASYICVGTVIFALWENW-------------SLVDGAYFCFVTLSTIGYGDFVPARSFNGPE 872
            |::|..::.:|.|:||....:             |:..|.::..||::||||||..| .::.|  
 Worm   349 LMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITP-HTYLG-- 410

  Fly   873 LQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIAVRLKLAR 915
            ..:.:.||  |.|::.:|:...::.:...........|.|:.:
 Worm   411 RLIGSICA--LAGVLTIALPVPVIVSNFAMFYSHTQARSKMPK 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 22/86 (26%)
shw-3NP_001355445.1 BTB_POZ 25..136 CDD:453885
Ion_trans 248..444 CDD:459842 23/99 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.