Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022268.1 | Gene: | twk-49 / 187626 | WormBaseID: | WBGene00019904 | Length: | 337 | Species: | Caenorhabditis elegans |
Alignment Length: | 213 | Identity: | 46/213 - (21%) |
---|---|---|---|
Similarity: | 85/213 - (39%) | Gaps: | 58/213 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 EMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEA-PQDISKS-- 106
Fly 107 -AAIAKSREDCLR----ELWIITEKLNVLYERNWT----MLVHEQLRRFEG--SIVAATRQGSAG 160
Fly 161 SSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIF 225
Fly 226 YALVGVPL------MLMC 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | 15/53 (28%) |
Ion_trans_2 | 822..896 | CDD:285168 | |||
twk-49 | NP_001022268.1 | Ion_trans_2 | <144..191 | CDD:369572 | 14/46 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |