DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-49

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001022268.1 Gene:twk-49 / 187626 WormBaseID:WBGene00019904 Length:337 Species:Caenorhabditis elegans


Alignment Length:213 Identity:46/213 - (21%)
Similarity:85/213 - (39%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEA-PQDISKS-- 106
            :|..:..|| |::..|:.|..|..    .:|...|:||...:.:.|...|.|.|. |.:::..  
 Worm    22 DMLERVKAS-TSRISSATRSPCFQ----RWSPVLLILLTTVFILFGATCFYLFERDPHEMTVRKW 81

  Fly   107 -AAIAKSREDCLR----ELWIITEKLNVLYERNWT----MLVHEQLRRFEG--SIVAATRQGSAG 160
             ..:|..|....|    .::..|..|.::.:|..|    .|:.|.|:|:|.  :||..:|     
 Worm    82 YMNLAVERRQFARTISSRIFNDTRNLLIIIDREQTERVQQLLVESLKRYEDKLTIVPPSR----- 141

  Fly   161 SSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIF 225
                                        :.||:..:..::.:::.|||.|...|.|...::..:|
 Worm   142 ----------------------------REWSWISSFNFAYSLLLTIGGGFKVPATVGSQIFAVF 178

  Fly   226 YALVGVPL------MLMC 237
            |.|:|:||      :::|
 Worm   179 YCLIGIPLFYSTLILIVC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 15/53 (28%)
Ion_trans_2 822..896 CDD:285168
twk-49NP_001022268.1 Ion_trans_2 <144..191 CDD:369572 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.