Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492381.3 | Gene: | twk-30 / 185335 | WormBaseID: | WBGene00006682 | Length: | 608 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 107/205 - (52%) | Gaps: | 28/205 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 LVLLVIG----YSVLGGLLFPLLEAPQ-DISKS---AAIAKSREDCLRELWIITEKLNVLYERNW 135
Fly 136 TMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYS 200
Fly 201 VTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRL---CCQLQR 262
Fly 263 HQEHRRKSTP 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | 18/55 (33%) |
Ion_trans_2 | 822..896 | CDD:285168 | |||
twk-30 | NP_492381.3 | Ion_trans_2 | 103..166 | CDD:285168 | 22/63 (35%) |
Ion_trans_2 | 224..298 | CDD:285168 | |||
FN3 | 379..469 | CDD:238020 | |||
FN3 | 475..565 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D542195at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |