DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-47

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001309491.1 Gene:twk-47 / 185227 WormBaseID:WBGene00018002 Length:500 Species:Caenorhabditis elegans


Alignment Length:87 Identity:19/87 - (21%)
Similarity:40/87 - (45%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GENDE-IKLYLSKLREL---VPFMPKNRKLSK--LEVIQNVIDYICELQNALDSHPAVNSFDSLA 89
            |.|.: :|....:|:||   |....|::.|||  |..::.:.:.:.:.....::.||:.:  .|.
 Worm   186 GSNSQVVKELRGRLKELERSVGDATKDKDLSKGALRRVKPMENVLYKASRVFNNCPAIAT--KLR 248

  Fly    90 VL------QQHQQQQQVGYMVE 105
            .:      |...|:.|..|:::
 Worm   249 AMNYNTEEQVQAQKNQAAYLMQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301
twk-47NP_001309491.1 Ion_trans_2 <122..180 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.