DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-35

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_508031.3 Gene:twk-35 / 185149 WormBaseID:WBGene00006687 Length:557 Species:Caenorhabditis elegans


Alignment Length:273 Identity:68/273 - (24%)
Similarity:108/273 - (39%) Gaps:78/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GLGGVGG-AGCGSEMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGL---VLLVIG--YSVLGG 91
            |..||.. ||.....|.:....|..||...|     .:|...:...||   ||:::.  |.:.||
 Worm    99 GAAGVWDIAGRAHLAGKRKVEQLQQKPPLWL-----VILNQAYHKYGLKHAVLIIVFLIYCISGG 158

  Fly    92 LLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRR-FEGSIVAATR 155
            |:|.|:|.|.            :..||:.|  ..|:    |.|.|..|...::: |..|...   
 Worm   159 LVFWLIEEPY------------QSELRDAW--QHKI----ENNRTARVDAMMKKIFNNSDYL--- 202

  Fly   156 QGSAGSSGGGGAGLFHEGSAS---------ALGHFGYDAG-----DSQSWSFSEALLYSVTVITT 206
                         ::.:|:.|         .||.:....|     ....|.|..|:|::.|:.||
 Worm   203 -------------IYIKGNTSQRLTTFFIEELGSYENQLGVKWSQQKMDWDFWNAVLFAGTICTT 254

  Fly   207 IGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTY---------VRLCC---- 258
            ||:|.:.|.|.||::.|:.:||.|:||||:.|...|.||...::..:         :..||    
 Worm   255 IGYGHIYPMTDAGRMLTMIFALFGIPLMLLVLQDFGKLLTITMKFPWFQTKRLMRRIMRCCTKQP 319

  Fly   259 -----QLQRHQEH 266
                 :::|.:.|
 Worm   320 IEEMKEIERQERH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 26/55 (47%)
Ion_trans_2 822..896 CDD:285168
twk-35NP_508031.3 Ion_trans_2 <237..294 CDD:285168 25/56 (45%)
Ion_trans_2 347..420 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.