DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-35

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_508031.3 Gene:twk-35 / 185149 WormBaseID:WBGene00006687 Length:557 Species:Caenorhabditis elegans


Alignment Length:96 Identity:22/96 - (22%)
Similarity:36/96 - (37%) Gaps:31/96 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITTMCAKNGGGASLPAIATGRVQRHRDGENDEIKLYLSKLRELVPFMPKNRKLSKLE-------V 61
            |..:|.|.|..|....: ||:            :||..:|       |.|  :|:::       |
 Worm   715 IIPLCFKAGEDAETLGL-TGQ------------ELYTIEL-------PNN--VSEIKPGQDVTVV 757

  Fly    62 IQNVIDYICELQNALDSHPAVNSFDSLAVLQ 92
            ..|...:.|.|:  .|:...:..||...:||
 Worm   758 TNNGKSFTCTLR--FDTEVELAYFDHGGILQ 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301
twk-35NP_508031.3 Ion_trans_2 230..294 CDD:462301
Ion_trans_2 345..420 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.