DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-28

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_508732.3 Gene:twk-28 / 183714 WormBaseID:WBGene00006680 Length:523 Species:Caenorhabditis elegans


Alignment Length:247 Identity:59/247 - (23%)
Similarity:104/247 - (42%) Gaps:66/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GLVLLVIGYSVLGGLLFPLLEAPQDIS----KSAAIAKSREDCLRELWIIT---------EKLNV 129
            |||:|:..|.:.|..||..||||:::.    :...|...|::....:|.||         |..|.
 Worm    64 GLVILLFLYLIAGAFLFRYLEAPKELETRNHELTTILGLRDEFQDHIWNITQDSDNRISREAFNA 128

  Fly   130 LYERNWTMLVHEQLRRFEGSIVAA------TRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDS 188
            :.:..:..||....:.:....:.|      ||:                              |.
 Worm   129 INQEYFEQLVKNMFQAYRNQFITAKHLLNKTRE------------------------------DE 163

  Fly   189 QSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTY 253
            ..|:|..::.::.|||||||:|:|.|.|..|::|.|.:||:|:||:|:.::.:|..|::.|...|
 Worm   164 VLWTFPNSMFFAATVITTIGYGNLVPITVTGRVACIIFALLGIPLLLVTIADIGKFLSEFLSYLY 228

  Fly   254 --------------VRLCCQLQRHQEHRRKSTPGTSTPSASSAANSREKDTD 291
                          .::..|.:...:.|..|..|:   |.:.:.|..:.|:|
 Worm   229 RSYRGFKRKLRRQSKKITSQYRSQSQSRSSSVMGS---SKAGSMNLHDIDSD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
twk-28NP_508732.3 Ion_trans_2 <166..222 CDD:285168 24/55 (44%)
Ion_trans_2 295..370 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.