DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-37

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_491810.2 Gene:twk-37 / 183583 WormBaseID:WBGene00006689 Length:382 Species:Caenorhabditis elegans


Alignment Length:267 Identity:51/267 - (19%)
Similarity:89/267 - (33%) Gaps:129/267 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEQAIKAKQPQPSQLDCSIDDETDATEFGGLGGVGGAGCGSEMGAKTTASLTAKPRSSLRRCCGH 68
            ||:..:|::|:|::|                                        |:.||:    
 Worm    69 VERKSRAERPKPTKL----------------------------------------RTILRK---- 89

  Fly    69 LLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDI----------------------SKSAAIAK 111
            :.|  |:|....::::.|.:.|.|||..:|:..|:                      ||...:.|
 Worm    90 IRK--FNTIIAFVVLVAYIIGGALLFWQIESRSDMNINEFKRNIRQKSIHIYNSMKGSKCGKLKK 152

  Fly   112 S----REDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHE 172
            :    ..:|::|::      ::||..|....:.|                               
 Worm   153 ADNELNNNCIKEIF------DLLYASNPPKHIEE------------------------------- 180

  Fly   173 GSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMC 237
                                |.:.|.|.:|.|||||:|.|...|.||||.|:.|.::|:.|.|..
 Worm   181 --------------------FLDGLAYVITCITTIGYGELVCHTIAGKLVTVAYGIIGIALTLYV 225

  Fly   238 LSSLGAL 244
            |.:.|.:
 Worm   226 LRNNGKI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/54 (43%)
Ion_trans_2 822..896 CDD:285168
twk-37NP_491810.2 Ion_trans_2 <181..235 CDD:285168 23/52 (44%)
Ion_trans_2 267..336 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.