DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and C27F2.6

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:99 Identity:26/99 - (26%)
Similarity:46/99 - (46%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 LLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARS--FNGPELQLYACCAYLL 883
            ||:.:..:...:.:|:..||.|....|||.|:|:..|.:||.||...  |:|       .|.:.|
 Worm    26 LLLCSISLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLVWFSG-------YCLFFL 83

  Fly   884 LGLVLVAMSFSILETQLMWKCKRIAVRLKLARAD 917
            :..||....|...:.::.:....:|.::.|.|.:
 Worm    84 ISDVLSNHIFYFFQARVRYFFHILARKILLLREE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 22/75 (29%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.