DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-39

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001076639.1 Gene:twk-39 / 182864 WormBaseID:WBGene00006690 Length:676 Species:Caenorhabditis elegans


Alignment Length:57 Identity:15/57 - (26%)
Similarity:25/57 - (43%) Gaps:12/57 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DSLAVLQQHQQQQQVGYMVESIDTVPAHPAAAASRQPLATILSSGSNVAASNINAIG 142
            |..|...|:||..|.| ....:|.:...|         ..:|::|:  :||:|.:.|
 Worm   204 DDEAASMQNQQYYQNG-RSRPLDDIHGLP---------QNLLTNGN--SASDIYSWG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301
twk-39NP_001076639.1 Ion_trans_2 <121..177 CDD:462301
Ion_trans_2 498..580 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.