DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and B0310.1

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001370323.1 Gene:B0310.1 / 181922 WormBaseID:WBGene00015137 Length:292 Species:Caenorhabditis elegans


Alignment Length:208 Identity:57/208 - (27%)
Similarity:85/208 - (40%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAP---QDISKSA--AIAK 111
            |.|..|.:.:.|||       ||.|    .:::.:..:|.:|||.|..|   ||.:::.  .:..
 Worm     3 ADLPPKFQYAFRRC-------LFYT----FVLVAWLFIGMILFPALCTPAVKQDDNEAGIFRLDA 56

  Fly   112 SREDCLRELW--IITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGS 174
            .|.|.|..||  .||..     |.:|:.|..::|..:|.::                        
 Worm    57 KRSDLLNVLWAETITNG-----EDDWSELADQKLELYEKAL------------------------ 92

  Fly   175 ASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLS 239
               |.|:|.|. |....||:..|..|..:.||||...:...|..|||..:.|||:|.||.|..:.
 Worm    93 ---LQHYGIDL-DKSDKSFASGLQKSFAISTTIGPLDVDDFTTLGKLIAVLYALIGTPLFLTVIG 153

  Fly   240 SLGALLADGLQCT 252
            .||.::....|.|
 Worm   154 QLGKMVTSVWQGT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 21/55 (38%)
Ion_trans_2 822..896 CDD:285168
B0310.1NP_001370323.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.