DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-44

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_509942.4 Gene:twk-44 / 181349 WormBaseID:WBGene00006694 Length:733 Species:Caenorhabditis elegans


Alignment Length:278 Identity:76/278 - (27%)
Similarity:116/278 - (41%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SLTAKPRSSLRRCCGHLLKLLFSTPGL-----VLLVIGYSVLGGLLFPLLEAPQD----ISKSAA 108
            |:..:| |.|:|... ||::::....:     ::|:|.|||||||:|..:|.|.:    ..|...
 Worm    43 SIVNRP-SKLKRFVS-LLQIIYDKSRVHYLVPIILLIAYSVLGGLIFWSIERPNEEIMLADKRNY 105

  Fly   109 IAKSREDCLRELWIITEKL---NVLYERN-WTMLVH----------------------------- 140
            ||...:|.:..|..|..:|   |.:|..| :.:::|                             
 Worm   106 IAALTDDLVEVLMQIHNRLIDFNRVYSNNTYLLMIHYRGYRKFALNQIHKSVYWYTLSTFYLTEH 170

  Fly   141 -------------EQL--RRFE---GSIVAA---TRQ--------GSAGSSGGG---------GA 167
                         |||  |.||   |.|.|.   |.|        |..|::.|.         ..
 Worm   171 EMHKVVALRPKNPEQLWKRHFESNFGRIRALKNYTEQLCLRCWELGVEGANQGWTRYNYSLMVNQ 235

  Fly   168 GLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
            .:....::..|||.     .:..|:|..|:..:||..||||:|::|.:|..||||.:.||:||:|
 Worm   236 SVEEYNNSVGLGHV-----LTPVWTFWNAMFLAVTTYTTIGYGNITAKTKLGKLAAMVYAVVGIP 295

  Fly   233 LMLMCLSSLGALLADGLQ 250
            |:||.|...|.|...||:
 Worm   296 LVLMILHKSGRLFLMGLE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 27/55 (49%)
Ion_trans_2 822..896 CDD:285168
twk-44NP_509942.4 Ion_trans_2 237..308 CDD:285168 29/75 (39%)
Ion_trans_2 354..>397 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.