Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509942.4 | Gene: | twk-44 / 181349 | WormBaseID: | WBGene00006694 | Length: | 733 | Species: | Caenorhabditis elegans |
Alignment Length: | 278 | Identity: | 76/278 - (27%) |
---|---|---|---|
Similarity: | 116/278 - (41%) | Gaps: | 87/278 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 SLTAKPRSSLRRCCGHLLKLLFSTPGL-----VLLVIGYSVLGGLLFPLLEAPQD----ISKSAA 108
Fly 109 IAKSREDCLRELWIITEKL---NVLYERN-WTMLVH----------------------------- 140
Fly 141 -------------EQL--RRFE---GSIVAA---TRQ--------GSAGSSGGG---------GA 167
Fly 168 GLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVP 232
Fly 233 LMLMCLSSLGALLADGLQ 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | 27/55 (49%) |
Ion_trans_2 | 822..896 | CDD:285168 | |||
twk-44 | NP_509942.4 | Ion_trans_2 | 237..308 | CDD:285168 | 29/75 (39%) |
Ion_trans_2 | 354..>397 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |