DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and egl-36

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_509795.1 Gene:egl-36 / 181269 WormBaseID:WBGene00001202 Length:558 Species:Caenorhabditis elegans


Alignment Length:144 Identity:30/144 - (20%)
Similarity:59/144 - (40%) Gaps:40/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 LRYHCDGKDCREAEDSEEE----------------DEKADGRQVPI------SLVLLILASYICV 830
            |.::.|....|..||..::                .:...|.|:.|      :..|::|..::.:
 Worm   303 LSFYADAMMVRVVEDEPKDVVEFLSMIRIFRLFKLTQHHQGLQILIHTFRASAKELILLVFFLIL 367

  Fly   831 GTVIFALWENW-------------SLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQLYACCAYL 882
            |.||||....:             |:..|.::...|::|:||||..|..||.   ..:.:.||  
 Worm   368 GIVIFAALVYYAEKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFG---RLVGSLCA-- 427

  Fly   883 LLGLVLVAMSFSIL 896
            ::|::.:|:...::
 Worm   428 VMGVLTIALPVPVI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 21/86 (24%)
egl-36NP_509795.1 BTB_POZ 36..147 CDD:453885
Ion_trans 203..451 CDD:459842 30/144 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.