DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-18

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001379714.1 Gene:twk-18 / 181139 WormBaseID:WBGene00006672 Length:461 Species:Caenorhabditis elegans


Alignment Length:251 Identity:64/251 - (25%)
Similarity:105/251 - (41%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLR 144
            :::::.|::||..:|.::|...:........|.|::.:|.......:|.:..:|. .|...|:..
 Worm    25 LIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRRTVYKINQLQIKRQRR-LMTAEEEYN 88

  Fly   145 RFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGH 209
            |  .:.|..|.|                   ..||....|......|:|..::.|.:||.||||:
 Worm    89 R--TAKVLTTFQ-------------------ETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGY 132

  Fly   210 GSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKSTPGT 274
            |::.|.|..|:.|||.||.:|:||.::.|..||:|.|.|        |..|.|   ...|||...
 Worm   133 GNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKG--------CKMLWR---FFLKSTRVV 186

  Fly   275 S---TPSASSAANSREKDTDKRSKRRMANCKGCQYDAANSETSLNDCLEYGQKGKL 327
            |   :...|.||::.|:.|...:.           .|..:|.:.:|.|.:...|.|
 Worm   187 SKDLSNKISEAADNIEEGTTAITP-----------SAEKTENNDDDLLSFPISGLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 25/55 (45%)
Ion_trans_2 822..896 CDD:285168
twk-18NP_001379714.1 Ion_trans_2 <114..170 CDD:400301 25/55 (45%)
Ion_trans_2 232..306 CDD:400301 64/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.