DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-17

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001024464.1 Gene:twk-17 / 181024 WormBaseID:WBGene00006671 Length:576 Species:Caenorhabditis elegans


Alignment Length:291 Identity:69/291 - (23%)
Similarity:116/291 - (39%) Gaps:92/291 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYER 133
            |||:|....||.:|::.|..:|..:|..|||..::....|..|...|...:  |:.|.:.:...:
 Worm   136 LLKILLPHVGLNVLLLSYIAMGATVFIWLEADHELEGRKAKVKHVFDIYSQ--IMNETIALTNNQ 198

  Fly   134 NWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYD-------------- 184
            :....:..::|....|:..|                 ||          ||              
 Worm   199 SDQATIVSRMRPLLESLSRA-----------------HE----------YDDKFTDTNQLWTGEQ 236

  Fly   185 AGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGL 249
            .|.:..|:|:.|.||::||||:.|:..:||.|..|::.|:|:.|:|:|||.:..:.:|..|::.:
 Worm   237 DGMTTRWTFAAATLYALTVITSTGYDHVTPATDPGRIFTVFFGLIGIPLMFITAADIGKFLSEIV 301

  Fly   250 QCTYVRLCCQLQRHQEHRRKSTPGTSTPSASSAANSREK------DTD---------KRSKRRMA 299
            ..||.:|....:                   ..||..|.      |||         |:||:|.|
 Worm   302 IRTYAKLLAMWK-------------------MIANLVELVRTHLFDTDVDSIDSMELKKSKKRNA 347

  Fly   300 NCKGCQYDAANSETSLND--CLEYGQKGKLP 328
                         :||:|  |.:...:.:||
 Worm   348 -------------SSLDDEECEDEEDRLQLP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 23/55 (42%)
Ion_trans_2 822..896 CDD:285168
twk-17NP_001024464.1 Ion_trans_2 <242..299 CDD:285168 23/56 (41%)
Ion_trans_2 371..449 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.