DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-16

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_508526.2 Gene:twk-16 / 180594 WormBaseID:WBGene00006670 Length:555 Species:Caenorhabditis elegans


Alignment Length:240 Identity:50/240 - (20%)
Similarity:94/240 - (39%) Gaps:72/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQL 143
            |::||:.||.|||.:|..:|.      :|.....|.:.:.....:::.|:.::  .|:   |.|.
 Worm    29 LLMLVLLYSFLGGFIFDRIET------NAHAEMKRNERINRTACVSQILHSIH--RWS---HNQT 82

  Fly   144 RRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIG 208
            .:.:                      :.|..|..   |..:..:...|:|..|.||...::||:|
 Worm    83 HKVQ----------------------YAEDIADC---FEPEKDERSEWNFVTATLYGFGIVTTLG 122

  Fly   209 HGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKSTPG 273
            :..:.|.|..|::..|.|.:.|:|:.::.::::|..|                            
 Worm   123 YNRIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYL---------------------------- 159

  Fly   274 TSTPSASSAANSREKDTDKRSKRRM--ANCKGCQYDAANSE-TSL 315
                 .:.|.:||.|....|.:|||  |:..|..|..::.: |||
 Worm   160 -----NNFAGDSRRKIEAYRQQRRMSKASLAGKIYKESSIQVTSL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 17/55 (31%)
Ion_trans_2 822..896 CDD:285168
twk-16NP_508526.2 Ion_trans_2 <102..159 CDD:285168 16/56 (29%)
Ion_trans_2 204..279 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.