DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-26

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_508522.2 Gene:twk-26 / 180592 WormBaseID:WBGene00006679 Length:519 Species:Caenorhabditis elegans


Alignment Length:207 Identity:54/207 - (26%)
Similarity:101/207 - (48%) Gaps:43/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWII---------TEKLNVLYERN 134
            |:.|::||..|||.:|..||:|:::          || |:|..::         |:.:||....|
 Worm    89 LIALLVGYVFLGGFMFEKLESPREL----------ED-LKETIVLMQGIIDEETTDIINVTLSTN 142

  Fly   135 WTMLVH---EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEA 196
            .|..|:   :.::|:..:::.|             .|.||    .::.|...:......|.||.|
 Worm   143 GTDRVNKLAKLIKRYYKTMLEA-------------EGRFH----GSVWHKAENLDMHLMWYFSSA 190

  Fly   197 LLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCC--- 258
            ..||:|:.:|||:|:::.:|..|:..::.||.:|:|:||:.|..:|......|...|:.|..   
 Worm   191 TFYSMTLFSTIGYGTISCQTVWGRTLSMIYASIGLPIMLVVLGDIGEWFQKILTNGYIFLLLKYK 255

  Fly   259 QLQRHQEHRRKS 270
            :|::...:|:|:
 Worm   256 KLRKQPVNRKKN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 21/55 (38%)
Ion_trans_2 822..896 CDD:285168
twk-26NP_508522.2 Ion_trans_2 <185..241 CDD:285168 21/55 (38%)
Ion_trans_2 278..>327 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.