DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-46

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:173 Identity:47/173 - (27%)
Similarity:76/173 - (43%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNW-TMLVHE 141
            ||.:.|: |..:|.::|..:|.|            .|...||.::.       |:..| ..|:  
 Worm    30 GLGVAVV-YLFVGAIVFVRIEYP------------LEKIEREAYLD-------YQNQWRDRLI-- 72

  Fly   142 QLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAG--DSQSWSFSEALLYSVTVI 204
            ||...|..|                ..||.....:||.....|..  ...:|:|.:|..::.|:|
 Worm    73 QLDIDESEI----------------DKLFLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTLI 121

  Fly   205 TTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLAD 247
            :|:|:|.::|||..|||.||.|.::|:||.|..||::.|.:.:
 Worm   122 STVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMRE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/55 (44%)
Ion_trans_2 822..896 CDD:285168
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 24/56 (43%)
Ion_trans_2 198..274 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.