DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-36

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_507485.2 Gene:twk-36 / 180164 WormBaseID:WBGene00006688 Length:562 Species:Caenorhabditis elegans


Alignment Length:187 Identity:50/187 - (26%)
Similarity:92/187 - (49%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLREL-WIITEKLNVLYERNWTMLVHEQ 142
            |::|.:.|::||..:|.|:|...:.|:.....::.:..|.|| .:::|.:|...:.:    .|::
 Worm   173 LLVLALIYTLLGATVFYLIEGSNEKSRLHVREQNLDKLLDELATVLSEAVNDPEQSS----EHQR 233

  Fly   143 LRRF-EGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITT 206
            ::.| :.|.::..:               ||.......::..:..|:..|:||.|..:|:.|.||
 Worm   234 MKEFIKESYISLQK---------------HEEQYKWSTYYRLEHPDNLKWTFSSAFFFSMNVYTT 283

  Fly   207 IGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG--------ALLADGLQCTYVR 255
            .|:||::.:|.:|:|.|:.||...||:.|:.|..||        .|.|.||  |.||
 Worm   284 TGYGSISAQTFSGQLFTMIYAFCFVPVTLVILRDLGQMFLVNFTKLYAHGL--TAVR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/63 (38%)
Ion_trans_2 822..896 CDD:285168
twk-36NP_507485.2 Ion_trans_2 255..322 CDD:285168 24/66 (36%)
Ion_trans_2 361..432 CDD:285168
Ion_trans <363..452 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.