DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-42

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_507483.1 Gene:twk-42 / 180163 WormBaseID:WBGene00006692 Length:444 Species:Caenorhabditis elegans


Alignment Length:115 Identity:33/115 - (28%)
Similarity:64/115 - (55%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 EAEDSEEEDEKADG-RQVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDF 862
            |...:....:..:| |.:|:.|||::|..::......||.:|||:|.:..||.|::::|||:|||
 Worm   207 ETSSTPPSPQNPNGTRPIPLLLVLIVLFFWMIQCVAYFAYFENWTLFESVYFFFISMTTIGFGDF 271

  Fly   863 VPARSFNGPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIAVRLK 912
            .|:.:.      ......::|.||.:|:|..::::.||.:...:|..|::
 Worm   272 TPSHTV------AVGGIVFILGGLSVVSMCINVIQMQLEFIFNQIVQRIE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 22/73 (30%)
twk-42NP_507483.1 Ion_trans_2 90..165 CDD:462301
Ion_trans_2 236..304 CDD:462301 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.