DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-33

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001309463.1 Gene:twk-33 / 180161 WormBaseID:WBGene00006685 Length:617 Species:Caenorhabditis elegans


Alignment Length:253 Identity:61/253 - (24%)
Similarity:105/253 - (41%) Gaps:52/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSQLDCSIDDETD-ATEFGGLGGVGGAGCGSEMGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPG 78
            |.:|...:...|| |:.|...|.         ||.....:|....: |:.....|..::.|....
 Worm   164 PGRLQHRLSVHTDAASRFSSPGA---------MGEPVVPTLRRFDK-SMYWFAFHRKQIGFRHFS 218

  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLREL-WIITEKLN----VLYERNWTML 138
            :|:||:.|::||.::|..:|:..:.:|:.....:.|..|..| ..|||.:|    ...|....:.
 Worm   219 VVILVLLYTLLGAVMFWTVESRHEKAKTLDHVNNLEHLLDRLAENITESVNNINTTTTEEEMKVY 283

  Fly   139 VHE---QLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYS 200
            :.|   :|.:.||.                     ::||.    ::..:|.|:..|:|..|..:|
 Worm   284 IREAYIELMKLEGQ---------------------YKGST----YYKLEADDNWKWTFESAFFFS 323

  Fly   201 VTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG--------ALLADGLQ 250
            :.|.||.|:||:.|.:..|::....|..:.||:.|:.|..||        .|.|.|:|
 Worm   324 MNVYTTTGYGSIAPESTLGQVLVCVYGFIFVPVTLVVLRDLGQFFLVHLTKLYAHGIQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 20/63 (32%)
Ion_trans_2 822..896 CDD:285168
twk-33NP_001309463.1 Hid1 <9..141 CDD:301632
Ion_trans_2 300..368 CDD:285168 23/71 (32%)
Ion_trans <404..498 CDD:278921
Ion_trans_2 407..491 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.