DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-34

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_506906.3 Gene:twk-34 / 180054 WormBaseID:WBGene00006686 Length:558 Species:Caenorhabditis elegans


Alignment Length:199 Identity:48/199 - (24%)
Similarity:82/199 - (41%) Gaps:43/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWI-ITEKLN----VLYERNWTML 138
            :.|:|:.|::.|..:|..:|:..:.:.:.....:.|:.|..|.. |||.:|    ...|....:.
 Worm   169 VALMVLSYTIFGAFMFWTVESRNERAVTLERVTNLENLLNILATNITEIVNNPNTTTTEAEMQVY 233

  Fly   139 VHE---QLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGY----DAGDSQSWSFSEA 196
            :.|   .|.:.||.                     ::||.       |    |.|.:..|:|..|
 Worm   234 IREAYVSLMKLEGQ---------------------YKGST-------YYKLEDHGKNWKWTFESA 270

  Fly   197 LLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQ 261
            ..:|:.|.||.|:||:.|.:..|::....|..:.||:.|:.|..||......|...|.:|   :|
 Worm   271 FFFSMNVYTTTGYGSIAPESILGQVLVCLYGFIFVPVTLVALRDLGQFFLVHLTKLYAQL---IQ 332

  Fly   262 RHQE 265
            |.:|
 Worm   333 RWRE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 22/73 (30%)
Ion_trans_2 822..896 CDD:462301
twk-34NP_506906.3 Ion_trans_2 250..319 CDD:462301 24/75 (32%)
Ion_trans_2 366..442 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.