DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and shl-1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_500975.2 Gene:shl-1 / 177400 WormBaseID:WBGene00022240 Length:578 Species:Caenorhabditis elegans


Alignment Length:141 Identity:34/141 - (24%)
Similarity:56/141 - (39%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRL 256
            |...|..|::..:||:|:|.:.|.|..||:.....:|.||.::        ||....:...:.|:
 Worm   357 SIPSAFWYTIVTLTTLGYGDMVPSTIMGKIVGGVCSLSGVLVI--------ALPVPVIVSNFSRI 413

  Fly   257 CCQLQRHQEHRRKSTPGTS----TPSASSAANSREKDTDKRSKRRMANCKG-CQYDAANSET--- 313
            ..|.||..:.:.:.....:    ..:||..|...:|..  ...|.:|..:| ..:||...|.   
 Worm   414 YHQNQRADKRKAQKKARLARIRIVKNASGLALFNKKRA--HEARMLAFEQGHLSFDALRDEDIFE 476

  Fly   314 ----SLNDCLE 320
                .|..|||
 Worm   477 IQHHHLLQCLE 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 16/54 (30%)
Ion_trans_2 822..896 CDD:462301
shl-1NP_500975.2 BTB_POZ 6..149 CDD:453885
Ion_trans 187..416 CDD:459842 17/66 (26%)
DUF3399 472..>511 CDD:463381 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.