DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-31

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001022884.1 Gene:twk-31 / 176572 WormBaseID:WBGene00006683 Length:1136 Species:Caenorhabditis elegans


Alignment Length:271 Identity:71/271 - (26%)
Similarity:112/271 - (41%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQAIKAKQPQPSQLDCSIDDETDATEFGGL---GGVGGAGCGSEMGAKTTASLTAKPRSSLRRCC 66
            |:..|...|:|::. ..:...|.....||.   |.:.|...|..:|...:      |.|.|.:|.
 Worm    77 EEYRKPAPPEPTKF-LQVSRTTVRMLAGGFSRAGSLEGVETGGIVGPPMS------PISFLGKCK 134

  Fly    67 GHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLY 131
            .:..|.........:|::.||.||..:|.|.|  .|..:...: |.|.| ||.|      .|..:
 Worm   135 HYYDKYKLDRISASVLLVLYSFLGAWVFYLFE--HDYEREVKL-KERID-LRML------RNDTF 189

  Fly   132 ERNWTMLVHEQ-LRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSE 195
            :|..:|:..:| |..||...:...::             .|.          ....:...|.:..
 Worm   190 QRISSMVFRQQGLANFEEVFIDYEKK-------------LHV----------VRLPECLDWDYWG 231

  Fly   196 ALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQL 260
            ||.|..|:.||||:|::.||||.|:.|::.||:||:||:|..||..|..:.|.|.          
 Worm   232 ALFYVGTLFTTIGYGNIYPRTALGRAASVVYAIVGIPLVLAILSKCGKWMTDSLS---------- 286

  Fly   261 QRHQEHRRKST 271
            ::.|:||.:.|
 Worm   287 EKWQQHRIQIT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 26/55 (47%)
Ion_trans_2 822..896 CDD:285168
twk-31NP_001022884.1 Ion_trans_2 <226..283 CDD:285168 26/56 (46%)
Ion_trans_2 347..423 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.