powered by:
Protein Alignment CG1688 and twk-5
DIOPT Version :9
Sequence 1: | NP_610516.1 |
Gene: | CG1688 / 36005 |
FlyBaseID: | FBgn0027589 |
Length: | 918 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021896.1 |
Gene: | twk-5 / 174756 |
WormBaseID: | WBGene00006660 |
Length: | 281 |
Species: | Caenorhabditis elegans |
Alignment Length: | 54 |
Identity: | 19/54 - (35%) |
Similarity: | 37/54 - (68%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 SFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALL 245
||.|.:.:....|:|||:|:..|:|.|.::.:||::::|:||:::.|.:.|..|
Worm 46 SFYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYL 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D774951at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11003 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.