DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and shw-1

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_001022089.1 Gene:shw-1 / 174331 WormBaseID:WBGene00008819 Length:619 Species:Caenorhabditis elegans


Alignment Length:108 Identity:28/108 - (25%)
Similarity:49/108 - (45%) Gaps:18/108 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 LLILASYICVGTVIFALW-----------ENW--SLVDGAYFCFVTLSTIGYGDFVPARSFNGPE 872
            |.:|..::.:|.||||..           ||.  |:..|.::..:|:.|||:||.||..|..   
 Worm   426 LFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLG--- 487

  Fly   873 LQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIAVRLKLAR 915
            ..:.:.||  |:|::.:|:...::.:...........|.||.:
 Worm   488 RLVGSVCA--LMGVLTIALPVPVIVSNFAMFYSHAQARSKLPK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 24/86 (28%)
shw-1NP_001022089.1 BTB_Shaw-like 100..211 CDD:349723
Ion_trans 264..521 CDD:459842 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.