Sequence 1: | NP_610516.1 | Gene: | CG1688 / 36005 | FlyBaseID: | FBgn0027589 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495727.1 | Gene: | twk-3 / 174321 | WormBaseID: | WBGene00006658 | Length: | 383 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 88/207 - (42%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 MGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIA 110
Fly 111 KSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLF----- 170
Fly 171 -HEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLM 234
Fly 235 LMCLSSLGALLA 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1688 | NP_610516.1 | Ion_trans_2 | <191..247 | CDD:285168 | 21/56 (38%) |
Ion_trans_2 | 822..896 | CDD:285168 | |||
twk-3 | NP_495727.1 | Ion_trans_2 | <134..190 | CDD:285168 | 21/56 (38%) |
Ion_trans_2 | 211..283 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7175 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D542195at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.770 |