DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and twk-3

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_495727.1 Gene:twk-3 / 174321 WormBaseID:WBGene00006658 Length:383 Species:Caenorhabditis elegans


Alignment Length:207 Identity:56/207 - (27%)
Similarity:88/207 - (42%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MGAKTTASLTAKPRSSLRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIA 110
            :.|.:.....|..||.|.:.  ||..|...| ||||..:.|::.|..||..:|.|:::       
 Worm    14 LSATSKDKKVATDRSLLNKY--HLGPLALHT-GLVLSCVTYALGGAYLFLSIEHPEEL------- 68

  Fly   111 KSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLF----- 170
            |.||..:||.    :.|...:..|.|    ..:...|.||...|::..........|..|     
 Worm    69 KRREKAIREF----QDLKQQFMGNIT----SGIENSEQSIEIYTKKLILMLEDAHNAHAFEYFFL 125

  Fly   171 -HEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLM 234
             ||             .....|:||.||:::.|.:..:|:|.:.|.:|.|::..|.|||:|:||.
 Worm   126 NHE-------------IPKDMWTFSSALVFTTTTVIPVGYGYIFPVSAYGRMCLIAYALLGIPLT 177

  Fly   235 LMCLSSLGALLA 246
            |:.::..|...|
 Worm   178 LVTMADTGKFAA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 21/56 (38%)
Ion_trans_2 822..896 CDD:285168
twk-3NP_495727.1 Ion_trans_2 <134..190 CDD:285168 21/56 (38%)
Ion_trans_2 211..283 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7175
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.