DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and sup-9

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:167 Identity:49/167 - (29%)
Similarity:72/167 - (43%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140
            |..|::..:.|.::|..:|..||...:|.:...:.:.|           |||...|  |.:...:
 Worm     8 TLSLIVCTLTYLLVGAAVFDALETENEILQRKLVQRVR-----------EKLKTKY--NMSNADY 59

  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205
            |.|   |.:||.:..               |:.        ||      .|.||.|..::.||||
 Worm    60 EIL---EATIVKSVP---------------HKA--------GY------QWKFSGAFYFATTVIT 92

  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242
            |||:|..||.|.|||:..:.|||.|:||.|:...|:|
 Worm    93 TIGYGHSTPMTDAGKVFCMLYALAGIPLGLIMFQSIG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301 29/66 (44%)
Ion_trans_2 822..896 CDD:462301
sup-9NP_494333.1 Ion_trans_2 <73..132 CDD:462301 29/71 (41%)
Ion_trans_2 168..242 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.