DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcng3

DIOPT Version :10

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_596917.2 Gene:Kcng3 / 171011 RGDID:628832 Length:433 Species:Rattus norvegicus


Alignment Length:95 Identity:23/95 - (24%)
Similarity:44/95 - (46%) Gaps:28/95 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 LLILASYICVGTVIFA----LWENW-----------SLVDGAYFCFVTLSTIGYGDF----VPAR 866
            :::|..:|||...||:    |.|:.           |:....::..::::|:||||.    ||.|
  Rat   320 MVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFASIPAACWWVIISMTTVGYGDMYPITVPGR 384

  Fly   867 SFNGPELQLYACCAYLLLGLVLVAMSFSIL 896
            ...|      .|   ::.|:||:|:..:.:
  Rat   385 ILGG------VC---VVSGIVLLALPITFI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 23/92 (25%)
Kcng3NP_596917.2 BTB_POZ_KCNG3 11..122 CDD:349729
Ion_trans 210..417 CDD:459842 23/95 (24%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.