DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1688 and Kcnk2

DIOPT Version :9

Sequence 1:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:185 Identity:45/185 - (24%)
Similarity:83/185 - (44%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCL-RELWIITEKLNVLYERNWTMLVHEQ 142
            :.|:|:.|.::|..:|..||.||:||:...|...:::.: :...:.:.:|:.|.::         
  Rat    65 IFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQNFIAQHACVNSTELDELIQQ--------- 120

  Fly   143 LRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTI 207
                   ||.|...|                    :...|.::.....|....:..::.||||||
  Rat   121 -------IVTAINAG--------------------IIPLGNNSNQVSHWDLGSSFFFAGTVITTI 158

  Fly   208 GHGSLTPRTAAGKLATIFYALVGVPLMLMCLS----SLGALLADGL---QCTYVR 255
            |.|:::|||..||:..|.|||:|:||....|:    .||.:...|:   :.|:::
  Rat   159 GFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 24/59 (41%)
Ion_trans_2 822..896 CDD:285168
Kcnk2NP_742039.1 Ion_trans_2 <139..196 CDD:285168 22/56 (39%)
Ion_trans_2 234..312 CDD:285168
Required for basal channel activity. /evidence=ECO:0000250|UniProtKB:P97438 354..426
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.